PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G34170.3
Common NameARF13
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family ARF
Protein Properties Length: 546aa    MW: 62370.4 Da    PI: 6.6269
Description AUXIN RESPONSE FACTOR 13
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G34170.3genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B365.67.6e-21124227199
                  EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-..TTHHHHHHHHT--TT-EEEEEE-SSSEE. CS
           B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvlt..kGWkeFvkangLkegDfvvFkldgrsefe 91 
                  f k+lt sdv+ sg l++pk++a e+     ++++ +++ l+ +d+ g++W++k+ +r++++r+++t  +GW+ F+  ++L +gD++v+   + +++e
  AT1G34170.3 124 FSKILTASDVSLSGGLIIPKQYAIECfppldMSQPISTQNLVAKDLYGQEWSFKHVFRGTPQRHMFTsgGGWSVFATTKRLIVGDIFVLL--RGENGE 219
                  889***************************9777888999***********************99997789*******************..449999 PP

                  .EEEEE-S CS
           B3  92 lvvkvfrk 99 
                  l+++++r+
  AT1G34170.3 220 LRFGIRRA 227
                  *****997 PP

2Auxin_resp39.81.9e-142693054683
   Auxin_resp  46 kmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                  +m+fe++d+se+r+ Gt++gv+d++p +W++S+WrsLk
  AT1G34170.3 269 RMQFEGKDFSEKRYDGTIIGVNDMSP-HWKDSEWRSLK 305
                  8*************************.*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.3E-33121241IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019364.45E-27121232IPR015300DNA-binding pseudobarrel domain
CDDcd100177.41E-22123226No hitNo description
PROSITE profilePS5086312.816124228IPR003340B3 DNA binding domain
SMARTSM010193.9E-26124228IPR003340B3 DNA binding domain
PfamPF023629.6E-19124227IPR003340B3 DNA binding domain
PfamPF065073.0E-10269305IPR010525Auxin response factor
PfamPF023091.0E-5431469IPR033389AUX/IAA domain
PROSITE profilePS5174521.108433525IPR000270PB1 domain
SuperFamilySSF542773.73E-8436509No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 546 aa     Download sequence    Send to blast
MENNGEMNAQ PELSVDITKT YMYEKLWNIC AGPLCVLPKP GEKVYYFPQG HIELIENSTR  60
DELDHIRPIF DLPSKLRCRV VAIDRKVDKN TDEVYAQISL MPDTTEVMTH NTTMDTRRPI  120
VYFFSKILTA SDVSLSGGLI IPKQYAIECF PPLDMSQPIS TQNLVAKDLY GQEWSFKHVF  180
RGTPQRHMFT SGGGWSVFAT TKRLIVGDIF VLLRGENGEL RFGIRRAKHQ QGHIPSSVIS  240
ANCMQHGVIA SVVNAFKTKC MFNVVYKPRM QFEGKDFSEK RYDGTIIGVN DMSPHWKDSE  300
WRSLKVQWDE LSPFLRPNQV SPWDIEHLIP SSDISQSSLK KKKHWLQLNE IGATLSNLWT  360
CQEIGQRSMN SPISVPEFSY PNAIEDSKFL SGLLLNHSLL AIPNENYNSD QMIQPRKEDI  420
TTEATTSCLL FGVDLTKVHM QGVAISRAVD LTAMHGYNQL IQKLEELFDL KDELRTRNQW  480
EIVFTNNEGA EMLVGDDPWP EFCNMAKRIF ICSKEEIKKM KLKNKFFQPE SKALTSSDVP  540
PNVTDN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1042233719361Auxin response factor 1
4ldw_A1e-1042233719361Auxin response factor 1
4ldw_B1e-1042233719361Auxin response factor 1
4ldx_A1e-1042233719361Auxin response factor 1
4ldx_B1e-1042233719361Auxin response factor 1
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO793565380.0
Genevisible256026_at0.0
Expression AtlasAT1G34170-
AtGenExpressAT1G34170-
ATTED-IIAT1G34170-
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). {ECO:0000256|RuleBase:RU004561}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G34170.3
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G34170
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY6804060.0AY680406.1 Arabidopsis thaliana ARF13 (At1g34170) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001154393.10.0auxin response factor 13
SwissprotQ9FX250.0ARFM_ARATH; Auxin response factor 13
TrEMBLF4HT520.0F4HT52_ARATH; Auxin response factor
STRINGAT1G34170.30.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM12276731
Representative plantOGRP5261578
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Remington DL,Vision TJ,Guilfoyle TJ,Reed JW
    Contrasting modes of diversification in the Aux/IAA and ARF gene families.
    Plant Physiol., 2004. 135(3): p. 1738-52
    [PMID:15247399]
  3. Okushima Y, et al.
    Functional genomic analysis of the AUXIN RESPONSE FACTOR gene family members in Arabidopsis thaliana: unique and overlapping functions of ARF7 and ARF19.
    Plant Cell, 2005. 17(2): p. 444-63
    [PMID:15659631]
  4. Axtell MJ,Snyder JA,Bartel DP
    Common functions for diverse small RNAs of land plants.
    Plant Cell, 2007. 19(6): p. 1750-69
    [PMID:17601824]
  5. Manzano C,Abraham Z,L
    Identification of ubiquitinated proteins in Arabidopsis.
    Plant Mol. Biol., 2008. 68(1-2): p. 145-58
    [PMID:18535787]
  6. Vernoux T, et al.
    The auxin signalling network translates dynamic input into robust patterning at the shoot apex.
    Mol. Syst. Biol., 2011. 7: p. 508
    [PMID:21734647]